PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009618496.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 305aa    MW: 34467.6 Da    PI: 6.5154
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009618496.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.85e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd  lv +v+++G+g+W++++   g++R+ k+c++rw +yl
   XP_009618496.1 14 KGPWTPEEDIMLVSYVQEHGPGNWRAVPTNTGLRRCSKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding47.44.5e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T +E++ ++++ + lG++ W++Ia++++  Rt++++k++w+++l
   XP_009618496.1  67 RGSFTDQEEKMIIQLQAVLGNK-WAAIASYLP-ERTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.822965IPR017930Myb domain
SuperFamilySSF466895.14E-3111108IPR009057Homeodomain-like
SMARTSM007176.6E-151363IPR001005SANT/Myb domain
PfamPF002497.8E-171461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.4E-241568IPR009057Homeodomain-like
CDDcd001676.96E-111661No hitNo description
PROSITE profilePS5129419.95266116IPR017930Myb domain
SMARTSM007172.5E-1566114IPR001005SANT/Myb domain
PfamPF002493.6E-1467112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-2569117IPR009057Homeodomain-like
CDDcd001672.48E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MGRPPCCDKI GVKKGPWTPE EDIMLVSYVQ EHGPGNWRAV PTNTGLRRCS KSCRLRWTNY  60
LRPGIKRGSF TDQEEKMIIQ LQAVLGNKWA AIASYLPERT DNDIKNYWNT HLKKKLKKFE  120
ASDLYSKEGH CLSPLNSSSR GQWERTLQTD INTAKQALQN ALSLEKSSPI PEYTTTDVKP  180
INLGCYSYIK QEGKVSTSTY ASSAENIAKL LKQWTRSDST NISEQSKASS STQLSCNNNA  240
TNEEFESLSS FESFEQSNSD QFSQSLTPEA GKLHCEISKR EVDDQVPLSV MLESWLFDEN  300
DDLLI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-27141164105MYB PROTO-ONCOGENE PROTEIN
1msf_C4e-27141164105C-Myb DNA-Binding Domain
1mse_C4e-27141164105C-Myb DNA-Binding Domain
1h8a_C4e-271411627128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009618496.10.0PREDICTED: myb-related protein 306-like
SwissprotP813921e-104MYB06_ANTMA; Myb-related protein 306
TrEMBLK4BBV21e-178K4BBV2_SOLLC; Uncharacterized protein
STRINGSolyc02g087960.2.11e-177(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47600.12e-97myb domain protein 94